Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Ribonuclease kappa(Rnasek)

Recombinant Mouse Ribonuclease kappa(Rnasek)

SKU:CSB-CF818345MO

Regular price ¥256,600 JPY
Regular price Sale price ¥256,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8K3C0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR

Protein Names:Recommended name: Ribonuclease kappa Short name= RNase K Short name= RNase kappa EC= 3.1.-.-

Gene Names:Name:Rnasek Synonyms:D11Bwg0434e

Expression Region:1-98

Sequence Info:full length protein

View full details