Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Resistin(Retn)

Recombinant Mouse Resistin(Retn)

SKU:CSB-EP019573MO

Regular price ¥140,100 JPY
Regular price Sale price ¥140,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q99P87

Gene Names: Retn

Organism: Mus musculus (Mouse)

AA Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Expression Region: 21-114aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 14.2 kDa

Alternative Name(s): Adipose tissue-specific secretory factor ;ADSFAdipose-specific cysteine-rich secreted protein A12-alpha;Cysteine-rich secreted protein FIZZ3

Relevance: Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.

Reference: Disulfide-dependent multimeric assembly of resistin family hormones.Patel S.D., Rajala M.W., Rossetti L., Scherer P.E., Shapiro L.Science 304:1154-1158(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details