Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Radiation-inducible immediate-early gene IEX-1(Ier3)

Recombinant Mouse Radiation-inducible immediate-early gene IEX-1(Ier3)

SKU:CSB-CF011002MO

Regular price ¥262,500 JPY
Regular price Sale price ¥262,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P46694

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFL

Protein Names:Recommended name: Radiation-inducible immediate-early gene IEX-1 Alternative name(s): Immediate early protein GLY96 Immediate early response 3 protein

Gene Names:Name:Ier3 Synonyms:Gly96, Iex1

Expression Region:1-153

Sequence Info:full length protein

View full details