Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein lifeguard 4(Tmbim4)

Recombinant Mouse Protein lifeguard 4(Tmbim4)

SKU:CSB-CF880542MO

Regular price ¥274,300 JPY
Regular price Sale price ¥274,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9DA39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADTDPGYPRSSIEDDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFQ ALRTFVHESPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSESLAVAAVVTFYD VYLVLQAFIMTTAVFLGLTAYTLQSKRDFTKFGAGLFAGLWILCLAGFLKLFFYSETMEL VLASLGALLFCGFIIYDTHSLMHRLSPEEYVIAAISLYMDIINLFLHLLKFLEAVNKK

Protein Names:Recommended name: Protein lifeguard 4 Alternative name(s): Transmembrane BAX inhibitor motif-containing protein 4 Z-protein

Gene Names:Name:Tmbim4 Synonyms:Lfg4

Expression Region:1-238

Sequence Info:full length protein

View full details