Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Prostate stem cell antigen(Psca)

Recombinant Mouse Prostate stem cell antigen(Psca)

SKU:CSB-YP018840MO

Regular price ¥140,000 JPY
Regular price Sale price ¥140,000 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: Psca

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P57096

AA Sequence: LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Tag info: N-terminal 6xHis-tagged

Expression Region: 21-95aa

Protein length: Full Length of Mature Protein

MW: 10.4 kDa

Alternative Name(s):

Relevance: May be involved in the regulation of cell proliferation.

Reference: Prostate stem cell antigen a cell surface marker overexpressed in prostate cancer.Reiter R.E., Gu Z., Watabe T., Thomas G., Szigeti K., Davis E., Wahl M., Nisitani S., Yamashiro J., le Beau M.M., Losa M., Witte O.N.Proc. Natl. Acad. Sci. U.S.A. 95:1735-1740(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details