Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Prolactin-3D1(Prl3d1)

Recombinant Mouse Prolactin-3D1(Prl3d1)

SKU:CSB-EP325555MO

Regular price ¥159,500 JPY
Regular price Sale price ¥159,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P18121

Gene Names: Prl3d1

Organism: Mus musculus (Mouse)

AA Sequence: SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC

Expression Region: 30-224aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 26.4 kDa

Alternative Name(s): Chorionic somatomammotropin hormone 1 Placental lactogen I

Relevance:

Reference: "Trophoblast-specific transcription from the mouse placental lactogen-I gene promoter." Shida M.M., Ng Y.K., Soares M.J., Linzer D.I.H. Mol. Endocrinol. 7:181-188(1993)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details