Recombinant Mouse Pre T-cell antigen receptor alpha(Ptcra)

SKU: CSB-CF018961MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P0C6B2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LPSGIAGTPFPSLAPPITLLVDGRQHMLVVCLVLDAAPPGLDNPVWFSAGNGSALDAFTYGPSLAPDGTWTSLAQLSLPSEELEAWEPLVCHTRPGAGGQNRSTHPLQLSGESSTARSCFPEPLGGTQRQVLWLSLLRLLLFKLLLLDVLLTCSHLRLHVLAGQHLQPPPSRKSLPPTHRIWT

Protein Names:Recommended name: Pre T-cell antigen receptor alpha Short name= pT-alpha Short name= pTa Alternative name(s): gp33 pT-alpha-TCR

Gene Names:Name:Ptcra

Expression Region:17-199

Sequence Info:full length protein