Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 1(Galnt1)

Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 1(Galnt1)

SKU:CSB-CF009203MO

Regular price ¥337,500 JPY
Regular price Sale price ¥337,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O08912

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKFAYCKVVLATSLVWVLLDMFLLLYFSECNKCEEKQERGLPAGDVLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNVTLPEIF

Protein Names:Recommended name: Polypeptide N-acetylgalactosaminyltransferase 1 EC= 2.4.1.41 Alternative name(s): Polypeptide GalNAc transferase 1 Short name= GalNAc-T1 Short name= pp-GaNTase 1 Protein-UDP acetylgalactosaminyltransferase 1 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1 Cleaved into the following chain: 1. Polypeptide N-acetylgalactosaminyltransferase 1 soluble form

Gene Names:Name:Galnt1

Expression Region:1-559

Sequence Info:full length protein

View full details