Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Platelet glycoprotein Ib beta chain(Gp1bb)

Recombinant Mouse Platelet glycoprotein Ib beta chain(Gp1bb)

SKU:CSB-CF009686MO

Regular price ¥268,400 JPY
Regular price Sale price ¥268,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P56400

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS

Protein Names:Recommended name: Platelet glycoprotein Ib beta chain Short name= GP-Ib beta Short name= GPIb-beta Short name= GPIbB Alternative name(s): CD_antigen= CD42c

Gene Names:Name:Gp1bb

Expression Region:27-206

Sequence Info:full length protein

View full details