Recombinant Mouse Phospholipid scramblase 4(Plscr4)

SKU: CSB-CF018210MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P58196

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPVASPSAGLPMGYYIPQQPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLSTMVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR

Protein Names:Recommended name: Phospholipid scramblase 4 Short name= PL scramblase 4 Alternative name(s): Ca(2+)-dependent phospholipid scramblase 4

Gene Names:Name:Plscr4

Expression Region:1-326

Sequence Info:full length protein