Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Peroxisomal membrane protein 2(Pxmp2)

Recombinant Mouse Peroxisomal membrane protein 2(Pxmp2)

SKU:CSB-CF019109MO

Regular price ¥274,500 JPY
Regular price Sale price ¥274,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P42925

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APAASRLRVESELGSLPKRALAQYLLLLKLYPVLTKAVSSGILSALGNLLAQTIEKKQRK DSRLLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYSVPPEVPWASVKRLLLDRLFFAPTFL LLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMA ALFWYAYLASLGK

Protein Names:Recommended name: Peroxisomal membrane protein 2 Alternative name(s): 22 kDa peroxisomal membrane protein

Gene Names:Name:Pxmp2 Synonyms:Pmp22

Expression Region:2-194

Sequence Info:Full length protein

View full details