Gene Bio Systems
Recombinant Mouse PDZK1-interacting protein 1(Pdzk1ip1)
Recombinant Mouse PDZK1-interacting protein 1(Pdzk1ip1)
SKU:CSB-CF887424MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CQH0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPE PGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM
Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein
Gene Names:Name:Pdzk1ip1 Synonyms:Map17
Expression Region:1-114
Sequence Info:full length protein
