Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Natural killer cells antigen CD94(Klrd1)

Recombinant Mouse Natural killer cells antigen CD94(Klrd1)

SKU:CSB-CF012470MO

Regular price ¥268,200 JPY
Regular price Sale price ¥268,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O54707

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI

Protein Names:Recommended name: Natural killer cells antigen CD94 Alternative name(s): Killer cell lectin-like receptor subfamily D member 1 CD_antigen= CD94

Gene Names:Name:Klrd1 Synonyms:Cd94

Expression Region:1-179

Sequence Info:full length protein

View full details