Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 subunit C2(Ndufc2)

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 subunit C2(Ndufc2)

CSB-CF863413MO
Regular price
¥172,700 JPY
Sale price
¥172,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CQ54

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHR QLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b

Gene Names:Name:Ndufc2

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share