
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q08AU7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGSTMEPPGGAYLHLGAVTSPVGTARMLQLAFGCTTFSLVAHRGGFGGVQGTFCMAAWGF CFAFSVLVVACEFTKLHSCLRLSWGNFTAAFAMLATLLCATAAVIYPLYFTRLECPPEPA GCMVRNFRLAASVFAGLLFLAYAAEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFG ALVHESRYGRYVATQWCVAVYSLCFMATVAVVVLSVMGHTAGLGCPFDRLVIVYTFLAVL LYLSAAVIWPVFCFDPKYGEPGRPADCLRGSCPWDSQLVVAIFTYVNLLLYIVDLAYSQR IRFVPTL
Protein Names:Recommended name: Myeloid-associated differentiation marker-like protein 2
Gene Names:Name:Myadml2
Expression Region:1-307
Sequence Info:full length protein
You may also like
-
Recombinant Human Myeloid-associated differentiation marker-like protein 2(MYADML2)
- Regular price
- ¥189,700 JPY
- Sale price
- ¥189,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Myeloid-associated differentiation marker-like protein 2(Myadml2)
- Regular price
- ¥189,700 JPY
- Sale price
- ¥189,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Amyloid-like protein 2(Aplp2)
- Regular price
- ¥234,300 JPY
- Sale price
- ¥234,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse RELT-like protein 2(Rell2)
- Regular price
- ¥189,300 JPY
- Sale price
- ¥189,300 JPY
- Regular price
-
- Unit price
- per
Sold out