Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Myelin protein P0(Mpz)

Recombinant Mouse Myelin protein P0(Mpz)

SKU:CSB-CF014774MO

Regular price ¥275,200 JPY
Regular price Sale price ¥275,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P27573

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IVVYTDREIYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGAFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIRYCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGLGESRKDKK

Protein Names:Recommended name: Myelin protein P0 Alternative name(s): Myelin peripheral protein Short name= MPP Myelin protein zero

Gene Names:Name:Mpz Synonyms:P0

Expression Region:30-248

Sequence Info:full length protein

View full details