Gene Bio Systems
Recombinant Mouse Muellerian-inhibiting factor(Amh),partial
Recombinant Mouse Muellerian-inhibiting factor(Amh),partial
SKU:CSB-EP001666MO
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P27106
Gene Names: Amh
Organism: Mus musculus (Mouse)
AA Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Expression Region: 450-552aa
Sequence Info: Partial
Source: E.coli
Tag Info: NO-tagged
MW: 11.3 kDa
Alternative Name(s): Anti-Muellerian hormone
Relevance: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Reference: "The genes for a spliceosome protein (SAP62) and the anti-Mullerian hormone (AMH) are contiguous." Dresser D.W., Hacker A., Lovell-Badge R., Guerrier D. Hum. Mol. Genet. 4:1613-1618(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
