Recombinant Mouse Muellerian-inhibiting factor(Amh),partial

Recombinant Mouse Muellerian-inhibiting factor(Amh),partial

CSB-EP001666MO
Regular price
¥104,700 JPY
Sale price
¥104,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P27106

Gene Names: Amh

Organism: Mus musculus (Mouse)

AA Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Expression Region: 450-552aa

Sequence Info: Partial

Source: E.coli

Tag Info: NO-tagged

MW: 11.3 kDa

Alternative Name(s): Anti-Muellerian hormone

Relevance: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Reference: "The genes for a spliceosome protein (SAP62) and the anti-Mullerian hormone (AMH) are contiguous." Dresser D.W., Hacker A., Lovell-Badge R., Guerrier D. Hum. Mol. Genet. 4:1613-1618(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share