Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Major urinary protein 2(Mup2)

Recombinant Mouse Major urinary protein 2(Mup2)

SKU:CSB-YP319316MO

Regular price ¥161,300 JPY
Regular price Sale price ¥161,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P11589

Gene Names: Mup2

Organism: Mus musculus (Mouse)

AA Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Expression Region: 19-180aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 20.7 kDa

Alternative Name(s):

Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.

Reference: Solution structure of a recombinant mouse major urinary protein.Luecke C., Franzoni L., Abbate F., Lohr F., Ferrari E., Sorbi R.T., Rueterjans H., Spisni A.Eur. J. Biochem. 266:1210-1218(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details