Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse LysM and putative peptidoglycan-binding domain-containing protein 3 (Lysmd3), partial

Recombinant Mouse LysM and putative peptidoglycan-binding domain-containing protein 3 (Lysmd3), partial

SKU:Q99LE3

Regular price ¥122,200 JPY
Regular price Sale price ¥122,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q99LE3

Gene Names: Lysmd3

Alternative Name(s):

Abbreviation: Recombinant Mouse Lysmd3 protein, partial

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 1-216aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MAGRNQNRTVSLPGIQASGHVLAFGNCTDNDMLEEDAEVYELRSRGKEKVRRSASRDRLDDIVILTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDIVPADGSLSSSESAGSFLKEVDRDIEQIVKCTDTKKENLNEVVSALTAQQVRFEPDNKSIHRKDPYYGADWGIG

MW: 31.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Essential for Golgi structural integrity.

Reference: "LysMD3 is a type II membrane protein without an in vivo role in the response to a range of pathogens." Yokoyama C.C., Baldridge M.T., Leung D.W., Zhao G., Desai C., Liu T.C., Diaz-Ochoa V.E., Huynh J.P., Kimmey J.M., Sennott E.L., Hole C.R., Idol R.A., Park S., Storek K.M., Wang C., Hwang S., Viehmann Milam A., Chen E. Virgin H.W. J Biol Chem 293: 6022-6038(2018)

Function:

View full details