Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

CSB-YP717533MO
Regular price
¥103,400 JPY
Sale price
¥103,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q64253

Gene Names: Ly6e

Organism: Mus musculus (Mouse)

AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Expression Region: 21-102aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.8 kDa

Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1 Short name: TSA-1

Relevance: Involved in T-cell development.

Reference: "Mouse stem cell antigen Sca-2 is a member of the Ly-6 family of cell surface proteins."Classon B.J., Coverdale L.Proc. Natl. Acad. Sci. U.S.A. 91:5296-5300(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share