Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Lithostathine-1(Reg1)

Recombinant Mouse Lithostathine-1(Reg1)

SKU:CSB-EP337329MO

Regular price ¥140,300 JPY
Regular price Sale price ¥140,300 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Cell Biology

Target / Protein: Reg1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P43137

AA Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-165aa

Protein length: Full Length of Mature Protein

MW: 32.2 kDa

Alternative Name(s): Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1

Relevance: Might act as an inhibitor of spontaneous calcium carbonate precipitation.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details