Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Leukotriene C4 synthase(Ltc4s)

Recombinant Mouse Leukotriene C4 synthase(Ltc4s)

SKU:CSB-CF013228MO

Regular price ¥231,200 JPY
Regular price Sale price ¥231,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q60860

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYF PLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVA MAALGLLVHFLPGTLRTALFRWLQMLLPMA

Protein Names:Recommended name: Leukotriene C4 synthase Short name= LTC4 synthase EC= 4.4.1.20 Alternative name(s): Leukotriene-C(4) synthase

Gene Names:Name:Ltc4s

Expression Region:1-150

Sequence Info:full length protein

View full details