Recombinant Mouse Kit ligand(Kitlg)

SKU: CSB-CF012376MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P20826

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Protein Names:Recommended name: Kit ligand Alternative name(s): Hematopoietic growth factor KL Mast cell growth factor Short name= MGF Steel factor Stem cell factor Short name= SCF c-Kit ligand Cleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG

Gene Names:Name:Kitlg Synonyms:Kitl, Mgf, Sl, Slf

Expression Region:26-273

Sequence Info:full length protein