Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Kallikrein-8(Klk8)

Recombinant Mouse Kallikrein-8(Klk8)

SKU:CSB-YP720268MO

Regular price ¥140,100 JPY
Regular price Sale price ¥140,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Signal Transduction

Uniprot ID: Q61955

Gene Names: Klk8

Organism: Mus musculus (Mouse)

AA Sequence: ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

Expression Region: 33-260aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 27.1 kDa

Alternative Name(s): Neuropsin

Relevance: Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury

Reference: "Expression and activity-dependent changes of a novel limbic-serine protease gene in the hippocampus." Chen Z.-L., Yoshida S., Kato K., Momota Y., Suzuki J., Tanaka T., Ito J., Nishino H., Aimoto S., Kiyama H., Shiosaka S. J. Neurosci. 15:5088-5097(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details