Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A(Ifi27l2a)

Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A(Ifi27l2a)

SKU:CSB-CF840289MO-GB

Regular price ¥251,300 JPY
Regular price Sale price ¥251,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8R412

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGA AVGALL

Protein Names:Recommended name: Interferon alpha-inducible protein 27-like protein 2A Alternative name(s): Interferon-stimulated gene 12 protein Short name= ISG12

Gene Names:Name:Ifi27l2a Synonyms:Ifi27, Isg12

Expression Region:25-90

Sequence Info:full length protein

View full details