Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g)

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g)

SKU:CSB-CF008533MO

Regular price ¥248,300 JPY
Regular price Sale price ¥248,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P20491

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ

Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit gamma Alternative name(s): Fc receptor gamma-chain Short name= FcRgamma Fc-epsilon RI-gamma IgE Fc receptor subunit gamma Short name= FceRI gamma

Gene Names:Name:Fcer1g Synonyms:Fce1g

Expression Region:19-86

Sequence Info:full length protein

View full details