Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Heme transporter HRG1(Slc48a1)

Recombinant Mouse Heme transporter HRG1(Slc48a1)

SKU:CSB-CF861573MO

Regular price ¥265,900 JPY
Regular price Sale price ¥265,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9D8M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPSRLQLGLRAAYSGFSSVAGFSIFFVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYM QDYWRTWLRGLRGFFFVGALFSAVSVSAFCTFLALAITQHQSLKDPNSYYLSCVWSFISF KWAFLLSLYAHRYRADFADISILSDF

Protein Names:Recommended name: Heme transporter HRG1 Alternative name(s): Heme-responsive gene 1 protein homolog Short name= HRG-1 Solute carrier family 48 member 1

Gene Names:Name:Slc48a1 Synonyms:Hrg1

Expression Region:1-146

Sequence Info:full length protein

View full details