
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P12850
Gene Names: Cxcl1
Organism: Mus musculus (Mouse)
AA Sequence: NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Expression Region: 29-96aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.5 kDa
Alternative Name(s): C-X-C motif chemokine 1;Platelet-derived growth factor-inducible protein KCSecretory protein N51
Relevance: Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hatopoietic activity.1 Publication
Reference: The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Growth-regulated alpha protein(CXCL1)
- Regular price
- ¥81,100 JPY
- Sale price
- ¥81,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Growth-regulated alpha protein(Cxcl1) (Active)
- Regular price
- ¥167,300 JPY
- Sale price
- ¥167,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Cxcl1 Antibody, FITC conjugated - Cat. #: CSB-PA09217C0Rb
- Regular price
- ¥49,400 JPY
- Sale price
- ¥49,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Cxcl1 Antibody - Cat. #: CSB-PA09217A0Rb
- Regular price
- ¥49,400 JPY
- Sale price
- ¥49,400 JPY
- Regular price
-
- Unit price
- per
Sold out