Gene Bio Systems
Recombinant Mouse E3 ubiquitin-protein ligase RNF5(Rnf5)
Recombinant Mouse E3 ubiquitin-protein ligase RNF5(Rnf5)
SKU:CSB-CF019894MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O35445
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AAAEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDR QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGAGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF5 EC= 6.3.2.- Alternative name(s): RING finger protein 5
Gene Names:Name:Rnf5 Synonyms:Ng2
Expression Region:2-180
Sequence Info:Full length protein
