Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse DnaJ homolog subfamily C member 4(Dnajc4)

Recombinant Mouse DnaJ homolog subfamily C member 4(Dnajc4)

SKU:CSB-CF872007MO

Regular price ¥285,300 JPY
Regular price Sale price ¥285,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9D844

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSLLLQLPLRLCRLWPHSLSIRLLTAATGQRSVPTNYYELLGVHPGASAEEIKRAFFTK SKELHPDRDPGNPALHSRFVELNEAYRVLSREESRRNYDHQLHSASPPKSSGSTAEPKYT QQTHSSWEPPNAQYWAQFHSVRPQGPESRKQQRKHNQRVLGYCLLLMVAGMGLHYVAFRK LEQVHRSFMDEKDRIITAIYNDTRARARANRARIQQERQQRQQPRAEPSLPPESSRIMPQ DTSP

Protein Names:Recommended name: DnaJ homolog subfamily C member 4 Alternative name(s): Multiple endocrine neoplasia type 1 candidate protein number 18 homolog

Gene Names:Name:Dnajc4 Synonyms:Mcg18

Expression Region:1-244

Sequence Info:full length protein

View full details