Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Diazepam-binding inhibitor-like 5(Dbil5)

Recombinant Mouse Diazepam-binding inhibitor-like 5(Dbil5)

SKU:CSB-EP520959MO-GB

Regular price ¥141,500 JPY
Regular price Sale price ¥141,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O09035

Gene Names: Dbil5

Organism: Mus musculus (Mouse)

AA Sequence: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC

Expression Region: 1-87aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13.9 kDa

Alternative Name(s): Endozepine-like peptide

Relevance: May be involved in the energy metabolism of the mature sperm.

Reference: "Progressive inactivation of the haploid expressed gene for the sperm-specific endozepine-like peptide (ELP) through primate evolution." Ivell R., Pusch W., Balvers M., Valentin M., Walther N., Weinbauer G. Gene 255:335-345(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details