Gene Bio Systems
Recombinant Mouse Diazepam-binding inhibitor-like 5(Dbil5)
Recombinant Mouse Diazepam-binding inhibitor-like 5(Dbil5)
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O09035
Gene Names: Dbil5
Organism: Mus musculus (Mouse)
AA Sequence: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
Expression Region: 1-87aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 13.9 kDa
Alternative Name(s): Endozepine-like peptide
Relevance: May be involved in the energy metabolism of the mature sperm.
Reference: "Progressive inactivation of the haploid expressed gene for the sperm-specific endozepine-like peptide (ELP) through primate evolution." Ivell R., Pusch W., Balvers M., Valentin M., Walther N., Weinbauer G. Gene 255:335-345(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.