
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P28654
Gene Names: Dcn
Organism: Mus musculus (Mouse)
AA Sequence: GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Expression Region: 35-354aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 51.9 kDa
Alternative Name(s): Bone proteoglycan IIPG-S2;PG40
Relevance: May affect the rate of fibrils formation.
Reference: Naitoh Y., Suzuki S. The murine decorin. Complete cDNA cloning, genomic organization, chromosomal assignment, and expression during organogenesis and tissue differentiation.Scholzen T., Solursh M., Suzuki S., Reiter R., Morgan J.L., Buchberg A.M., Siracusa L.D., Iozzo R.V.J. Biol. Chem. 269:28270-28281(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Decorin(Dcn),partial
- Regular price
- ¥103,700 JPY
- Sale price
- ¥103,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Decorin(Dcn),partial
- Regular price
- ¥103,400 JPY
- Sale price
- ¥103,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Decorin(Dcn) ,partial
- Regular price
- ¥103,700 JPY
- Sale price
- ¥103,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Stromelysin-1(Mmp3)
- Regular price
- ¥103,700 JPY
- Sale price
- ¥103,700 JPY
- Regular price
-
- Unit price
- per
Sold out