Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse D-dopachrome decarboxylase(Ddt)

Recombinant Mouse D-dopachrome decarboxylase(Ddt)

SKU:CSB-YP006598MO

Regular price ¥161,500 JPY
Regular price Sale price ¥161,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: O35215

Gene Names: Ddt

Organism: Mus musculus (Mouse)

AA Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL

Expression Region: 2-118aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 14.9 kDa

Alternative Name(s): D-dopachrome tautomerase

Relevance: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Reference: Cloning of the mouse gene for D-dopachrome tautomerase.Kuriyama T., Fujinaga M., Koda T., Nishihira J.Biochim. Biophys. Acta 1388:506-512(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details