Gene Bio Systems
Recombinant Mouse Cytokine receptor common subunit gamma(Il2rg)
Recombinant Mouse Cytokine receptor common subunit gamma(Il2rg)
SKU:CSB-CF011651MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P34902
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA
Protein Names:Recommended name: Cytokine receptor common subunit gamma Alternative name(s): Interleukin-2 receptor subunit gamma Short name= IL-2 receptor subunit gamma Short name= IL-2R subunit gamma Short name= IL-2RG gammaC p64 CD_antigen= CD132
Gene Names:Name:Il2rg
Expression Region:23-369
Sequence Info:full length protein
