Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cytokine receptor common subunit gamma(Il2rg)

Recombinant Mouse Cytokine receptor common subunit gamma(Il2rg)

SKU:CSB-CF011651MO

Regular price ¥299,000 JPY
Regular price Sale price ¥299,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P34902

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA

Protein Names:Recommended name: Cytokine receptor common subunit gamma Alternative name(s): Interleukin-2 receptor subunit gamma Short name= IL-2 receptor subunit gamma Short name= IL-2R subunit gamma Short name= IL-2RG gammaC p64 CD_antigen= CD132

Gene Names:Name:Il2rg

Expression Region:23-369

Sequence Info:full length protein

View full details