Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cytochrome c oxidase subunit 6C(Cox6c)

Recombinant Mouse Cytochrome c oxidase subunit 6C(Cox6c)

SKU:CSB-CF875094MO

Regular price ¥252,400 JPY
Regular price Sale price ¥252,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CPQ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMK DFEEMRKAGIFQSAK

Protein Names:Recommended name: Cytochrome c oxidase subunit 6C Alternative name(s): Cytochrome c oxidase polypeptide VIc

Gene Names:Name:Cox6c

Expression Region:2-76

Sequence Info:full length protein

View full details