Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cytochrome b5 type B(Cyb5b)

Recombinant Mouse Cytochrome b5 type B(Cyb5b)

SKU:CSB-CF863430MO

Regular price ¥263,600 JPY
Regular price Sale price ¥263,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CQX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KVEGSEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNSCQSSWAYWFVPIVGAIL IGFLYRHFWADSKSS

Protein Names:Recommended name: Cytochrome b5 type B Alternative name(s): Cytochrome b5 outer mitochondrial membrane isoform

Gene Names:Name:Cyb5b Synonyms:Cyb5m

Expression Region:12-146

Sequence Info:full length protein

View full details