Gene Bio Systems
Recombinant Mouse Cytochrome b5 type B(Cyb5b)
Recombinant Mouse Cytochrome b5 type B(Cyb5b)
SKU:CSB-CF863430MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CQX2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KVEGSEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNSCQSSWAYWFVPIVGAIL IGFLYRHFWADSKSS
Protein Names:Recommended name: Cytochrome b5 type B Alternative name(s): Cytochrome b5 outer mitochondrial membrane isoform
Gene Names:Name:Cyb5b Synonyms:Cyb5m
Expression Region:12-146
Sequence Info:full length protein
