Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cystatin-C(Cst3)

Recombinant Mouse Cystatin-C(Cst3)

SKU:CSB-EP006091MO

Regular price ¥107,300 JPY
Regular price Sale price ¥107,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P21460

Gene Names:Cst3

Organism:Mus musculus (Mouse)

AA Sequence:ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

Expression Region:21-140aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:20.4 kDa

Alternative Name(s):Cystatin-3

Relevance:As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

Reference:"Transforming growth factor beta regulates cystatin C in serum-free mouse embryo (SFME) cells." Solem M., Rawson C., Lindburg K., Barnes D. Biochem. Biophys. Res. Commun. 172:945-951(1990)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Cystatin family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=4263

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:13010

STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000028938

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details