Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial

Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial

SKU:Q8VCH2

Regular price ¥123,700 JPY
Regular price Sale price ¥123,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q8VCH2

Gene Names: Cd300ld

Alternative Name(s): CLM-5;CD300 antigen like family member D;Leukocyte mono-Ig-like receptor 4;Myeloid-associated immunoglobulin-like receptor 4;MAIR-4;MAIR-IV

Abbreviation: Recombinant Mouse Cd300ld protein, partial

Organism: Mus musculus (Mouse)

Source: Yeast

Expression Region: 19-177aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QDSVTGPEEVSGQEQGSLTVQCRYSSYWKGYKKYWCRGVPQRSCDILVETDKSEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGPDPMFKVNVNIDQAPKSSMMTTTATVLKSIQPSAENTGKEQVTQSKEVTQSRPHTRSLLSSIY

MW: 20.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Acts as an activating receptor in myeloid cells and mast cells. ; (Microbial infection) Acts as a functional murine norovirus (MNV) receptor. Primary determinant of MNV species tropism and is sufficient to render cells permissive to infection by MNV. Can render nonmurine mammalian cells susceptible to MNV infection.

Reference:

Function:

View full details