Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)

Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)

SKU:CSB-EP005196MO

Regular price ¥133,900 JPY
Regular price Sale price ¥133,900 JPY
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P05208

Gene Names: Cela2a

Organism: Mus musculus (Mouse)

AA Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Expression Region: 31-271aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 29.7 kDa

Alternative Name(s): Elastase-2Elastase-2A

Relevance: Acts upon elastin.

Reference: Sequence organisation and transcriptional regulation of the mouse elastase II and trypsin genes.Stevenson B.J., Hagenbuechle O., Wellauer P.K.Nucleic Acids Res. 14:8307-8330(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)