Gene Bio Systems
Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)
Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)
SKU:CSB-EP005196MO
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P05208
Gene Names: Cela2a
Organism: Mus musculus (Mouse)
AA Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Expression Region: 31-271aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 29.7 kDa
Alternative Name(s): Elastase-2Elastase-2A
Relevance: Acts upon elastin.
Reference: Sequence organisation and transcriptional regulation of the mouse elastase II and trypsin genes.Stevenson B.J., Hagenbuechle O., Wellauer P.K.Nucleic Acids Res. 14:8307-8330(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.