Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Chemokine-like protein TAFA-1(Tafa1)

Recombinant Mouse Chemokine-like protein TAFA-1(Tafa1)

SKU:CSB-EP763174MO

Regular price ¥148,400 JPY
Regular price Sale price ¥148,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Epigenetics and Nuclear Signaling

Uniprot ID:Q7TPG8

Gene Names:Tafa1

Organism:Mus musculus(Mouse)

AA Sequence:MLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT

Expression Region:20-133aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:20.2 kDa

Alternative Name(s):Fam19a1

Relevance:Regulatory factor which is ligand for GPR1 and is involved in the modulation of neural stem-cell proliferation and differentiation.

Reference:"FAM19A1 is a new ligand for GPR1 that modulates neural stem-cell proliferation and differentiation." Zheng C., Chen D., Zhang Y., Bai Y., Huang S., Zheng D., Liang W., She S., Peng X., Wang P., Mo X., Song Q., Lv P., Huang J., Ye R.D., Wang Y. FASEB J. 0:0-0(2018)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details