Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cadherin-17(Cdh17),partial

Recombinant Mouse Cadherin-17(Cdh17),partial

SKU:CSB-EP882608MO

Regular price ¥86,000 JPY
Regular price Sale price ¥86,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:Q9R100

Gene Names:Cdh17

Organism:Mus musculus (Mouse)

AA Sequence:INDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDP

Expression Region:173-253aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:13.1 kDa

Alternative Name(s):BILL-cadherin (Liver-intestine cadherin) (LI-cadherin) (P130)

Relevance:Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine.

Reference:"Mechanisms involved in vitamin D mediated intestinal calcium absorption and in non-classical actions of vitamin D." Christakos S., Dhawan P., Ajibade D., Benn B.S., Feng J., Joshi S.S. J. Steroid Biochem. Mol. Biol. 121:183-187(2010)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details