
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q6W5C0
Gene Names: Cxcl3
Organism: Mus musculus (Mouse)
AA Sequence: SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Expression Region: 32-100aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.6 kDa
Alternative Name(s): Dendritic cell inflammatory protein 11
Relevance: Ligand for CXCR2. Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Reference: IL-10-conditioned dendritic cells, decommissioned for recruitment of adaptive immunity, elicit innate inflammatory gene products in response to danger signals.Nolan K.F., Strong V., Soler D., Fairchild P.J., Cobbold S.P., Croxton R., Gonzalo J.-A., Rubio A., Wells M., Waldmann H.J. Immunol. 172:2201-2209(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse C-X-C motif chemokine 3 protein(Cxcl3) (Active)
- Regular price
- ¥170,800 JPY
- Sale price
- ¥170,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse C-X-C motif chemokine 10(Cxcl10)
- Regular price
- ¥105,900 JPY
- Sale price
- ¥105,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Cxcl3 Antibody - Cat. #: CSB-PA09239A0Rb
- Regular price
- ¥50,400 JPY
- Sale price
- ¥50,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse C-X-C motif chemokine 2 protein(Cxcl2)
- Regular price
- ¥105,900 JPY
- Sale price
- ¥105,900 JPY
- Regular price
-
- Unit price
- per
Sold out