Recombinant Mouse C-X-C motif chemokine 3 protein(Cxcl3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse C-X-C motif chemokine 3 protein(Cxcl3)

CSB-RP092394m
Regular price
¥105,900 JPY
Sale price
¥105,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q6W5C0

Gene Names: Cxcl3

Organism: Mus musculus (Mouse)

AA Sequence: SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Expression Region: 32-100aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.6 kDa

Alternative Name(s): Dendritic cell inflammatory protein 11

Relevance: Ligand for CXCR2. Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Reference: IL-10-conditioned dendritic cells, decommissioned for recruitment of adaptive immunity, elicit innate inflammatory gene products in response to danger signals.Nolan K.F., Strong V., Soler D., Fairchild P.J., Cobbold S.P., Croxton R., Gonzalo J.-A., Rubio A., Wells M., Waldmann H.J. Immunol. 172:2201-2209(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse C-X-C motif chemokine 3 protein(Cxcl3) (Active)
    Regular price
    ¥170,800 JPY
    Sale price
    ¥170,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse C-X-C motif chemokine 10(Cxcl10)
    Regular price
    ¥105,900 JPY
    Sale price
    ¥105,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Cxcl3 Antibody - Cat. #: CSB-PA09239A0Rb
    Regular price
    ¥50,400 JPY
    Sale price
    ¥50,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse C-X-C motif chemokine 2 protein(Cxcl2)
    Regular price
    ¥105,900 JPY
    Sale price
    ¥105,900 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share