Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse C-X-C motif chemokine 2 protein(Cxcl2)

Recombinant Mouse C-X-C motif chemokine 2 protein(Cxcl2)

SKU:CSB-RP092274m

Regular price ¥158,300 JPY
Regular price Sale price ¥158,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P10889

Gene Names: Cxcl2

Organism: Mus musculus (Mouse)

AA Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Expression Region: 28-100aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.8 kDa

Alternative Name(s): Macrophage inflammatory protein 2 ;MIP2

Relevance: Chotactic for human polymorphonuclear leukocytes but does not induce chokinesis or an oxidative burst.

Reference: Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details