Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Beta-tectorin(Tectb)

Recombinant Mouse Beta-tectorin(Tectb)

SKU:CSB-CF023371MO

Regular price ¥146,500 JPY
Regular price Sale price ¥146,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: O08524

Gene Names: Tectb

Organism: Mus musculus (Mouse)

AA Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Expression Region: 18-305aa

Sequence Info: Full Length of Mature Protein

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-tagged

MW: 36.5 kDa

Alternative Name(s):

Relevance: One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.

Reference: "The mouse tectorins. Modular matrix proteins of the inner ear homologous to components of the sperm-egg adhesion system."Legan P.K., Rau A., Keene J.N., Richardson G.P.J. Biol. Chem. 272:8791-8801(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details