Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Beta-1,3-N-acetylglucosaminyltransferase manic fringe(Mfng)

Recombinant Mouse Beta-1,3-N-acetylglucosaminyltransferase manic fringe(Mfng)

SKU:CSB-CF013757MO

Regular price ¥294,500 JPY
Regular price Sale price ¥294,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O09008

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHCRLFRGMAGALFTLLCVGLLSLRYHSSLSQRMIQGALRLNQRNPGPLELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTNCSAEHSHPALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLLAAP

Protein Names:Recommended name: Beta-1,3-N-acetylglucosaminyltransferase manic fringe EC= 2.4.1.222 Alternative name(s): O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Gene Names:Name:Mfng

Expression Region:1-321

Sequence Info:full length protein

View full details