Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs

SKU:P19437

Regular price ¥235,300 JPY
Regular price Sale price ¥235,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P19437

Gene Names: Ms4a1

Alternative Name(s): B-cell differentiation antigen Ly-44;Lymphocyte antigen 44;Membrane-spanning 4-domains subfamily A member 1;CD antigen CD20

Abbreviation: Recombinant Mouse Ms4a1 protein-VLPs

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 1-291aa

Protein Length: Full Length

Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Target Protein Sequence: MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

MW: 33.7 kDa

Purity: The purity information is not available for VLPs proteins.

Endotoxin: Not test

Biological_Activity:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Relevance: B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.

Reference:

Function:

View full details