Gene Bio Systems
Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain(Cd79b)
Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain(Cd79b)
SKU:CSB-CF004958MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P15530
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Protein Names:Recommended name: B-cell antigen receptor complex-associated protein beta chain Alternative name(s): B-cell-specific glycoprotein B29 Ig-beta Immunoglobulin-associated B29 protein CD_antigen= CD79b
Gene Names:Name:Cd79b Synonyms:Igb
Expression Region:26-228
Sequence Info:full length protein
