Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse ATP synthase subunit f, mitochondrial(Atp5j2)

Recombinant Mouse ATP synthase subunit f, mitochondrial(Atp5j2)

SKU:CSB-CF002370MO

Regular price ¥249,000 JPY
Regular price Sale price ¥249,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P56135

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASLVPLKEKKLMEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGIS MVLAAYVVFSYCISYKELKHERRRKYH

Protein Names:Recommended name: ATP synthase subunit f, mitochondrial

Gene Names:Name:Atp5j2

Expression Region:2-88

Sequence Info:Full length protein

View full details