Gene Bio Systems
Recombinant Mouse Amphiregulin(Areg)
Recombinant Mouse Amphiregulin(Areg)
SKU:CSB-CF001986MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P31955
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLE VVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHL WKRYFREYEGETEERRRLRQENGTVHAIA
Protein Names:Recommended name: Amphiregulin Short name= AR Alternative name(s): Schwannoma-derived growth factor Short name= SDGF
Gene Names:Name:Areg Synonyms:Sdgf
Expression Region:100-248
Sequence Info:Full length protein
