Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Amphiregulin(Areg)

Recombinant Mouse Amphiregulin(Areg)

SKU:CSB-CF001986MO

Regular price ¥266,100 JPY
Regular price Sale price ¥266,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P31955

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLE VVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHL WKRYFREYEGETEERRRLRQENGTVHAIA

Protein Names:Recommended name: Amphiregulin Short name= AR Alternative name(s): Schwannoma-derived growth factor Short name= SDGF

Gene Names:Name:Areg Synonyms:Sdgf

Expression Region:100-248

Sequence Info:Full length protein

View full details