Gene Bio Systems
Recombinant Mouse Alpha-2,8-sialyltransferase 8B(St8sia2)
Recombinant Mouse Alpha-2,8-sialyltransferase 8B(St8sia2)
SKU:CSB-CF022775MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O35696
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT
Protein Names:Recommended name: Alpha-2,8-sialyltransferase 8B EC= 2.4.99.- Alternative name(s): Polysialic acid synthase Sialyltransferase 8B Short name= SIAT8-B Sialyltransferase X Short name= STX Sialytransferase St8Sia II Short name= ST8SiaII
Gene Names:Name:St8sia2 Synonyms:Siat8b, Stx
Expression Region:1-375
Sequence Info:full length protein
